Sermorelin is a synthetic peptide made of the first 29 amino acids of human growth-hormone-releasing hormone (GHRH), with an amide at the end of the chain. It is the shortest fragment of GHRH that still fully activates the GHRH receptor, and is also written GRF (1-29) or GHRH (1-29).
Technical details
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
|---|---|
| Formula | C149H246N44O42S |
| Molecular weight | 3357.9 g/mol |
| CAS | 86168-78-7 |
| Form | Freeze-dried powder, 10 mg per vial |
| Research to date | Extensive published literature |
Lab certificate
A third-party certificate of analysis for the current batch will be posted on this page once testing is complete.
Storage
Store the sealed vial in a freezer at around -20 °C, away from light and moisture.
For laboratory research use only. Not for human or veterinary use, and not for diagnostic or therapeutic purposes.
